PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0022s0203.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family G2-like
Protein Properties Length: 282aa    MW: 31482.9 Da    PI: 5.8374
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0022s0203.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like94.58.2e-30157210155
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          +prl+Wtp+LH+rFve+v++L G ++A+Pkti+++m+v+gLt+e+v+SHLQkYRl
  Kalax.0022s0203.1.p 157 RPRLVWTPQLHKRFVEVVSHL-GLNNAVPKTIMQMMNVDGLTRENVASHLQKYRL 210
                          59*******************.9*******************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.144154213IPR017930Myb domain
SuperFamilySSF466896.63E-20155214IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.7E-29156214IPR009057Homeodomain-like
TIGRFAMsTIGR015577.9E-24158210IPR006447Myb domain, plants
PfamPF002491.1E-8160209IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042753Biological Processpositive regulation of circadian rhythm
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MDDQYRSGSG DAGADVNHLD EEDDIDDQRV SEWEAGLPNI HDLTPLSQPL IPHDLATAFS  60
ISPEPYRTLL DVTRASDNTI STLRCSNNSF APSNNKARPP HAQLLAIDST TMMLIDDDAA  120
ADPRKSRRLD SAAEEADSAL RTDNSADDQT SARALKRPRL VWTPQLHKRF VEVVSHLGLN  180
NAVPKTIMQM MNVDGLTREN VASHLQKYRL YLKRQSGEGP ALSDQLFSSD PYPHHLRQQP  240
PVMPMGIHSA NPPPYHPFDS HQHFSMMQHQ QQLRDWSSAN N*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A6e-20154216264ARR10-B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00014PBMTransfer from AT3G46640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015874010.17e-85PREDICTED: transcription factor PCL1
SwissprotQ9SNB44e-64PCL1_ARATH; Transcription factor LUX
TrEMBLF6GUZ07e-83F6GUZ0_VITVI; Putative uncharacterized protein
STRINGVIT_06s0004g05120.t012e-82(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46640.26e-65G2-like family protein